DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and RLP7

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_014396.3 Gene:RLP7 / 855730 SGDID:S000004947 Length:322 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:82/274 - (29%)
Similarity:137/274 - (50%) Gaps:47/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVKKPAAKKLPAVPESKLKFSKKQ--ISKRVAES--KRRLKKAAVIALRKKENLVRAEKYQNEYI 65
            :.||...:::.....:|.||.:.:  ::|.:|.|  |.|:|:.:::..:|.:|..:......::|
Yeast    36 LAKKKREEQIKKKRSNKNKFVRAESIVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFI 100

  Fly    66 --------KAEQREIKLRRLAKK------RNQFYVPAEAKLAFVVRIRG---INKVAPKVRKVLQ 113
                    .||:..:.|....::      |.:.....:..|.|:||:||   :| :..|..|:|.
Yeast   101 LKITEKANGAEENSVDLEETEEEEDDGLIREKTTYDGKPALLFIVRVRGPLAVN-IPNKAFKILS 164

  Fly   114 LFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQ------RVPI 172
            |.||.:.|.|||:||.|....:|::..||:..|.|:|.|:|.||.|||.:.:..:      .:.:
Yeast   165 LLRLVETNTGVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVL 229

  Fly   173 TDNFVIERKLRQAHQIQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDF 237
            .||.::|.:|.. |.|.||||::|||.|:|.:|...:.||.|||||....|             |
Yeast   230 NDNNIVEEQLGD-HGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSG-------------F 280

  Fly   238 GNREDQINRLLRKM 251
            |:    :|| |||:
Yeast   281 GS----LNR-LRKI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 80/260 (31%)
Ribosomal_L30_N 20..90 CDD:285340 16/87 (18%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 64/169 (38%)
RLP7NP_014396.3 Ribosomal_L7_archeal_euk 141..322 CDD:100099 64/169 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S407
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.