DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and AT1G80750

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_178190.1 Gene:AT1G80750 / 844414 AraportID:AT1G80750 Length:247 Species:Arabidopsis thaliana


Alignment Length:247 Identity:91/247 - (36%)
Similarity:137/247 - (55%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AKKLPAVPESKLKFSKKQ-----ISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQR 70
            ||.|..:||..||..|.:     |.|:..|.....||.     :|..::.|.|.:.:|:...|..
plant     6 AKGLDYIPEIVLKKRKNRDELAFIRKKQLELGNSGKKK-----KKVSDIKRPEDFVHEFRAKEVD 65

  Fly    71 EIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINM 135
            .|::::..|:......|.::.|.|::||:|.|.:.||.:::|...:|:.:..|||.|...:....
plant    66 MIRMKQRVKRPKSSPPPVKSDLVFIIRIQGKNDMHPKTKRILNNLQLKSVFTGVFAKATDSLFQK 130

  Fly   136 LRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFT 200
            |...:||:|:||||.|||::||||:|........||:|||.:||:.|.: |:|..:||||:||..
plant   131 LLKVQPYVTYGYPNDKSVKDLIYKKGCTIIEGNPVPLTDNNIIEQALGE-HKILGIEDLVNEIAR 194

  Fly   201 VGPNFKYASNFLWPFKLNTPTGG-WRKKANHYVNGGDFGNREDQINRLLRKM 251
            ||.:|:....||.|.|||.|... ..:|...:..|||.|||||:||.|:.||
plant   195 VGDHFREVMRFLGPLKLNKPVADVLHRKKQVFSEGGDTGNREDKINDLISKM 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 87/239 (36%)
Ribosomal_L30_N 20..90 CDD:285340 16/74 (22%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 70/161 (43%)
AT1G80750NP_178190.1 uL30_euk 14..247 CDD:273548 87/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544778at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.