DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and RPL7

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_000962.2 Gene:RPL7 / 6129 HGNCID:10363 Length:248 Species:Homo sapiens


Alignment Length:243 Identity:145/243 - (59%)
Similarity:183/243 - (75%) Gaps:7/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRK-KENLV--RAEKYQNEYIKAEQREIK 73
            |::|||||:   ..||:.:....:.||..||.|...||| :..|:  :|:.|..||.:..:.||:
Human     9 KEVPAVPET---LKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIR 70

  Fly    74 LRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRI 138
            :.|:|:|...||||||.|||||:||||||.|:|||||||||.|||||.||.|:|||||:||||||
Human    71 MARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRI 135

  Fly   139 AEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFTVGP 203
            .||||.|||||||||.|||||||:.|.|::|:.:|||.:|.|.|.: :.|.|:|||:|||:|||.
Human   136 VEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGK-YGIICMEDLIHEIYTVGK 199

  Fly   204 NFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKM 251
            .||.|:||||||||::|.||.:||..|:|.|||.||||||||||:|:|
Human   200 RFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 140/236 (59%)
Ribosomal_L30_N 20..90 CDD:285340 25/72 (35%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 112/160 (70%)
RPL7NP_000962.2 4 X 12 AA tandem repeats 7..54 17/47 (36%)
uL30_euk 16..248 CDD:273548 140/236 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148531
Domainoid 1 1.000 151 1.000 Domainoid score I4376
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H87772
Inparanoid 1 1.050 279 1.000 Inparanoid score I2929
Isobase 1 0.950 - 0 Normalized mean entropy S407
OMA 1 1.010 - - QHG53947
OrthoDB 1 1.010 - - D1544778at2759
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 1 1.000 - - oto89146
orthoMCL 1 0.900 - - OOG6_100755
Panther 1 1.100 - - LDO PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1237
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.720

Return to query results.
Submit another query.