DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and rpl7l1

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_955884.1 Gene:rpl7l1 / 322251 ZFINID:ZDB-GENE-030131-970 Length:247 Species:Danio rerio


Alignment Length:251 Identity:101/251 - (40%)
Similarity:155/251 - (61%) Gaps:14/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KPAAKK-LPAVPESKLK------FSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYI 65
            :|..:| :..|||:.||      ..|...:|...:.|:|::|......::.|..::..:      
Zfish     3 EPGTEKVIKLVPENLLKKRKAYQAIKANQAKLALQQKKRVQKGIPFKFKRLEEFLQNSR------ 61

  Fly    66 KAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNK 130
            :..:.|.:|.||.|:......||:..|||.||||.|..|:|||..|:|:.|||:|.:|.|:|::|
Zfish    62 RKHRDETRLARLKKRPPPPMPPAKNSLAFAVRIREIKGVSPKVMNVIQMLRLRKIFSGTFVKVSK 126

  Fly   131 ATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLV 195
            .:||||:..|||:.|||||||||||||.|||..|.:::::|:|||.:||:.|.: :.|.|:|||:
Zfish   127 HSINMLKTVEPYVAWGYPNLKSVRELILKRGQGKVDKRKIPLTDNTLIEQHLGK-YGIICLEDLI 190

  Fly   196 HEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKM 251
            |||::.|.||:..:||||||:|:.|....|.|.....:.|:.|.|.:.||.::||:
Zfish   191 HEIYSAGKNFRVVNNFLWPFRLSVPRHAARDKVGLMKDVGNPGPRAEDINTVIRKL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 97/239 (41%)
Ribosomal_L30_N 20..90 CDD:285340 15/75 (20%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 81/160 (51%)
rpl7l1NP_955884.1 uL30_euk 15..247 CDD:273548 97/239 (41%)
Ribosomal_L30_N 16..75 CDD:285340 12/64 (19%)
Ribosomal_L7_archeal_euk 88..247 CDD:100099 81/160 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582447
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544778at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.