DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and Npsr1

DIOPT Version :10

Sequence 1:NP_523531.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_783609.1 Gene:Npsr1 / 319239 MGIID:2441738 Length:371 Species:Mus musculus


Alignment Length:107 Identity:20/107 - (18%)
Similarity:37/107 - (34%) Gaps:33/107 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RRLAKKRNQFYVPAEAKLAFVVRIRGINKV-------------APKVRKVLQLFRLRQINNGVFI 126
            ||..|.|..|:|   .:||......|:..:             ||.:  |.::.|..|:      
Mouse    76 RRKRKSRMTFFV---TQLAITDSFTGLINILTDIIWRFTGDFMAPDL--VCRVVRYLQV------ 129

  Fly   127 KLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQ 168
                    :|..|..|:.... ::.....::|...|::..:|
Mouse   130 --------VLLYASTYVLVSL-SIDRYHAIVYPMKFLQGEKQ 162

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_523531.1 uL30_euk 19..252 CDD:273548 20/107 (19%)
Npsr1NP_783609.1 7tmA_NPSR 50..341 CDD:320325 20/107 (19%)