DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and Rpl7

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001094004.1 Gene:Rpl7 / 297755 RGDID:735169 Length:260 Species:Rattus norvegicus


Alignment Length:255 Identity:148/255 - (58%)
Similarity:187/255 - (73%) Gaps:14/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKPAA-------KKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRK-KENLV--RAEKYQ 61
            ||.||       ||:|||||:   ..||:.:....:.||..||.|:..||| :..|:  :|:.|.
  Rat     9 KKVAAAPGTLKKKKVPAVPET---LKKKRRNFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYH 70

  Fly    62 NEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFI 126
            .||.:..:.||::.|:|:|...||||||.|||||:||||||.|:|||||||||.|||||.||.|:
  Rat    71 KEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV 135

  Fly   127 KLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCV 191
            |||||::|||||.||||.|||||||||.|||||||:.|.|::|:.:|||.::.|.|.: ..|.|:
  Rat   136 KLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLVARSLGK-FGIICM 199

  Fly   192 EDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKM 251
            |||:|||:|||..||.|:||||||||::|.||.:||..|:|.|||.||||||||||:|:|
  Rat   200 EDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 138/236 (58%)
Ribosomal_L30_N 20..90 CDD:285340 25/72 (35%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 110/160 (69%)
Rpl7NP_001094004.1 5 X 12 AA tandem repeats 7..66 22/59 (37%)
uL30_euk 28..260 CDD:273548 138/236 (58%)
Ribosomal_L30_N 29..99 CDD:285340 25/72 (35%)
Ribosomal_L7_archeal_euk 101..260 CDD:100099 110/160 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342427
Domainoid 1 1.000 149 1.000 Domainoid score I4312
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H87772
Inparanoid 1 1.050 280 1.000 Inparanoid score I2823
OMA 1 1.010 - - QHG53947
OrthoDB 1 1.010 - - D1544778at2759
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 1 1.000 - - otm44931
orthoMCL 1 0.900 - - OOG6_100755
Panther 1 1.100 - - LDO PTHR11524
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1237
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.