DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and RPL7L1

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001353410.1 Gene:RPL7L1 / 285855 HGNCID:21370 Length:255 Species:Homo sapiens


Alignment Length:247 Identity:94/247 - (38%)
Similarity:144/247 - (58%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKE-------NLVRAEKYQNEYIKAEQ 69
            :|:|.|||:.||..|...:.:..::|:.|       |.|||       ...|.|.:.::..:.::
Human    16 RKIPLVPENLLKKRKAYQALKATQAKQAL-------LAKKEQKKGKGLRFKRLESFLHDSWRQKR 73

  Fly    70 REIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATIN 134
            .:::||||..|.:...:|.:..|||||||..|:.|:..|::.:...||::|.:|||:|:....:.
Human    74 DKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVKVTPQNLK 138

  Fly   135 MLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIF 199
            ||||.|||:|||:||||||||||.|||..|...:.:|:|||.|||..|.:...| |:|||:|||.
Human   139 MLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPLTDNTVIEEHLGKFGVI-CLEDLIHEIA 202

  Fly   200 TVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKM 251
            ..|.:|:..|.||.||.|:......:.:.......|..|.|.::||:|:|::
Human   203 FPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERINQLIRQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 90/240 (38%)
Ribosomal_L30_N 20..90 CDD:285340 17/76 (22%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 72/160 (45%)
RPL7L1NP_001353410.1 uL30_euk 23..255 CDD:273548 90/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148532
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544778at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.