DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and Rpl7

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_035421.2 Gene:Rpl7 / 19989 MGIID:98073 Length:270 Species:Mus musculus


Alignment Length:251 Identity:148/251 - (58%)
Similarity:185/251 - (73%) Gaps:7/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRK-KENLV--RAEKYQNEYI 65
            |...|...||:|||||:   ..||:.:....:.||..||.|:..||| :..|:  :|:.|..||.
Mouse    23 PAGPKTLKKKVPAVPET---LKKKRRNFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYR 84

  Fly    66 KAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNK 130
            :..:.||::.|:|:|...||||||.|||||:||||||.|:|||||||||.|||||.||.|:||||
Mouse    85 QMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNK 149

  Fly   131 ATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLV 195
            |:||||||.||||.|||||||||.|||||||:.|.|::|:.:|||.:|.|.|.: ..|.|:|||:
Mouse   150 ASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGK-FGIICMEDLI 213

  Fly   196 HEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKM 251
            |||:|||..||.|:||||||||::|.||.:||..|:|.|||.||||||||||:|:|
Mouse   214 HEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 140/236 (59%)
Ribosomal_L30_N 20..90 CDD:285340 25/72 (35%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 112/160 (70%)
Rpl7NP_035421.2 6 X 12 AA tandem repeats 7..76 20/55 (36%)
uL30_euk 38..270 CDD:273548 140/236 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838643
Domainoid 1 1.000 149 1.000 Domainoid score I4416
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H87772
Inparanoid 1 1.050 282 1.000 Inparanoid score I2868
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53947
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 1 1.000 - - oto92711
orthoMCL 1 0.900 - - OOG6_100755
Panther 1 1.100 - - LDO PTHR11524
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1144
SonicParanoid 1 1.000 - - X1237
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.