DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ripalpha and RPAIN

DIOPT Version :9

Sequence 1:NP_609351.1 Gene:Ripalpha / 34351 FlyBaseID:FBgn0032189 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001153715.1 Gene:RPAIN / 84268 HGNCID:28641 Length:231 Species:Homo sapiens


Alignment Length:198 Identity:46/198 - (23%)
Similarity:84/198 - (42%) Gaps:41/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AKRQRMGNQMPRLREMLREKYRK-----------------------RIIETRNRCTDAQREIQLS 64
            |.|||...:|...|:.|..:||:                       ..:::...|.:     .|:
Human    24 AFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPE-----DLA 83

  Fly    65 ELREILRLE-LSELEKDVELEELILEE--LLSDVNEWYALGEKNLETLYAEPDEQQKEVLCPVCQ 126
            :|.|::.:. |.|::     :|||.:|  ::|:..:.....||.|..:.||  .:...::||||.
Human    84 QLEELIDMAVLEEIQ-----QELINQEQSIISEYEKSLQFDEKCLSIMLAE--WEANPLICPVCT 141

  Fly   127 IKNLRHHKGAFICECGIRF-EHSANM--EQLQILLQQQIASHELQCTQALRFFIEPASGQLYDMC 188
            ..|||...|..:|:||:.. .||:.:  ::|:..|:..|..|...|.....|.:...:.:...:.
Human   142 KYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLL 206

  Fly   189 GSC 191
            .||
Human   207 MSC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RipalphaNP_609351.1 RPA_interact_C 122..196 CDD:291434 21/73 (29%)
RPAINNP_001153715.1 RPA_interact_N 8..46 CDD:291432 8/21 (38%)
RPA_interact_M 60..124 CDD:291433 13/73 (18%)
RPA_interact_C 137..211 CDD:291434 21/73 (29%)
Mediates nuclear export 164..180 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1518754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106367
Panther 1 1.100 - - LDO PTHR31742
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.