DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ripalpha and AT4G12760

DIOPT Version :9

Sequence 1:NP_609351.1 Gene:Ripalpha / 34351 FlyBaseID:FBgn0032189 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_193012.2 Gene:AT4G12760 / 826888 AraportID:AT4G12760 Length:258 Species:Arabidopsis thaliana


Alignment Length:231 Identity:44/231 - (19%)
Similarity:84/231 - (36%) Gaps:71/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 REMLREKYRKRIIETRNR---------CTDA-QREIQLSELREILRLELSELEKD---------- 80
            ::..||...:|:.|.|.|         |..: |:||.....::|:..||.::|..          
plant    29 KQKFRENCFRRVREDRTRLLWKLRISDCQSSDQKEIINCAFQDIVSDELKKIEDSSRNLSGNKTL 93

  Fly    81 ---------------------------VELEELILEELLSDVN---------EWYALGEKNLETL 109
                                       :|::::..::|||:.|         .|....:..|..|
plant    94 TEDCDDILWEYEEGLKGVYEGDSEEILLEMQQIFYKDLLSETNVNGSFVQVETWEDEEDDYLAAL 158

  Fly   110 YAE-----PDEQQKEVLCPVCQ----IKNLRHHKGAFICECGIRFEHSANMEQLQILLQQQIASH 165
            .::     .::::.::.||:|:    ::|.| |....:|:..:......|:..||..|.:....|
plant   159 VSQNMCLNSEQEESQIWCPICKKGELMENHR-HIDCNMCDMQLNKGEEVNLNILQERLAEAHGEH 222

  Fly   166 ELQ--CTQALRFFIEPASG--QLYDMCGSCDYFSSV 197
             ||  |.....|.::....  .||..|.:|..|..|
plant   223 -LQRGCRLKPEFSVQSVYNLKALYITCEACKTFEVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RipalphaNP_609351.1 RPA_interact_C 122..196 CDD:291434 21/81 (26%)
AT4G12760NP_193012.2 RPA_interact_N 12..52 CDD:291432 6/22 (27%)
RPA_interact_M 68..159 CDD:291433 11/90 (12%)
RPA_interact_C 176..256 CDD:291434 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1518754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106367
Panther 1 1.100 - - LDO PTHR31742
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.