DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ripalpha and Rpain

DIOPT Version :9

Sequence 1:NP_609351.1 Gene:Ripalpha / 34351 FlyBaseID:FBgn0032189 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_081462.1 Gene:Rpain / 69723 MGIID:1916973 Length:219 Species:Mus musculus


Alignment Length:238 Identity:51/238 - (21%)
Similarity:98/238 - (41%) Gaps:66/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STQSPVYRTSVEQ--KRHAQEVAKR---QRMGNQMPRL---------------------REMLRE 41
            |:.|| :|...:|  ..|.:|..::   :||.|...||                     :|::.|
Mouse     4 SSGSP-HRLLYKQVGSPHWKETFRQGCLERMRNSRHRLLNKYRQAAGSTPGTASDRLLVQEVMEE 67

  Fly    42 KYRKRIIETRNRCTDAQREIQLS-ELREILRLE----------LSELEKDVELEELILEELLSDV 95
            ::..  :::...|.:|..:::|. :|..:..:|          :||.|:|:|.:|..|..:|:  
Mouse    68 EWAS--LQSVENCPEALLQLELPLDLAVLQDIEQELCNEEKSIISEYEEDLEFDESCLRRMLA-- 128

  Fly    96 NEWYALGEKNLETLYAEPDEQQKEVLCPVCQIKNLRHHKGAFICECGIRFE-HSANM--EQLQIL 157
             ||.|                 ..::||||...|||.......|.||:... ||.::  ::|:..
Mouse   129 -EWEA-----------------NSLICPVCIKYNLRIMNSVVTCPCGLHIPVHSTDLTEQKLRAC 175

  Fly   158 LQQQIASHELQCTQALRFFIEPASGQ---LYDMCGSCDYFSSV 197
            |::.:..|.:.|.....|.:...:.:   |...|.:||.::.:
Mouse   176 LEENVNEHSVHCPHTPVFSVTGGTEEKPSLLMNCLTCDTWAVI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RipalphaNP_609351.1 RPA_interact_C 122..196 CDD:291434 21/79 (27%)
RpainNP_081462.1 RPA_interact_N 8..46 CDD:291432 10/38 (26%)
RPA_interact_M 59..123 CDD:291433 13/65 (20%)
RPA_interact_C 137..217 CDD:291434 21/79 (27%)
Mediates nuclear export. /evidence=ECO:0000250 164..180 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106367
Panther 1 1.100 - - LDO PTHR31742
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.