DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ripalpha and Rpain

DIOPT Version :9

Sequence 1:NP_609351.1 Gene:Ripalpha / 34351 FlyBaseID:FBgn0032189 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001028232.2 Gene:Rpain / 287463 RGDID:1308492 Length:219 Species:Rattus norvegicus


Alignment Length:225 Identity:48/225 - (21%)
Similarity:90/225 - (40%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SPVYRTSVEQ--------KRHAQEVAKRQR------MGNQMPRL--REMLREKYRKRIIETRNRC 54
            ||.::.:..|        .||  ::..|.|      :|....||  :|::.|::..  :::...|
  Rat    18 SPPWKETFRQGCLERMRNSRH--KLLNRYRQAAGSTLGTASDRLLVQEVMEEEWNS--LQSVENC 78

  Fly    55 TDAQREIQL-----------SELREILRLELSELEKDVELEELILEELLSDVNEWYALGEKNLET 108
            .:|..:::|           .||....:..:||.||.::.:|..|..:|:   ||.|        
  Rat    79 PEALLQLELPLNLAVLQDIEQELWNEEKSIISEYEKGLQFDESCLNSMLA---EWEA-------- 132

  Fly   109 LYAEPDEQQKEVLCPVCQIKNLRHHKGAFICECGIRF-EHSANM--EQLQILLQQQIASHELQCT 170
                     ..::||||...|||.......|.||:.. .||.::  ::|:..|:..:..|...|.
  Rat   133 ---------NPLICPVCIKYNLRIMNSVVTCPCGLHIPSHSTDLTEQKLRACLEGNVNEHSAHCP 188

  Fly   171 QALRFFIEPASGQ---LYDMCGSCDYFSSV 197
            ....|.:...:.:   |...|.:||.::.:
  Rat   189 HIPEFSVTGGTEEKPSLLMSCLACDTWAVI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RipalphaNP_609351.1 RPA_interact_C 122..196 CDD:291434 21/79 (27%)
RpainNP_001028232.2 Mediates nuclear export. /evidence=ECO:0000250 164..180 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1518754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106367
Panther 1 1.100 - - LDO PTHR31742
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.