DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ripalpha and rpain

DIOPT Version :9

Sequence 1:NP_609351.1 Gene:Ripalpha / 34351 FlyBaseID:FBgn0032189 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001120254.1 Gene:rpain / 100145305 XenbaseID:XB-GENE-5817170 Length:226 Species:Xenopus tropicalis


Alignment Length:206 Identity:45/206 - (21%)
Similarity:81/206 - (39%) Gaps:57/206 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 REKYRKRIIE----TRNRCTDAQREIQLSE-----------LREILRLE---------------- 73
            :|.||||.:|    .|::..|..|  |:.|           ::|::..|                
 Frog    19 KETYRKRCVERLKSNRSKLLDKFR--QVGERIHGGVGGSFLVQEVMEEEWKAMQFENGSFPSMWK 81

  Fly    74 -------LSELEKDVEL-------EELILEE--LLSDVNEWYALGEKNLETLYAEPDEQQKEVLC 122
                   |:.::...||       :||:|||  ::.:........|:.|:::.......|  ::|
 Frog    82 KEAFSQALTIMQDPDELATFEEIKQELLLEEKAMVDEFENILQFEEQCLDSVVGLSTGDQ--IVC 144

  Fly   123 PVCQIKNLRHHKGAFICECGIRF---EHSANMEQLQILLQQQIASHELQCTQALRFFIEP---AS 181
            |||....|.......:|:||:..   ....::|:|..||:..:.:|...||:...|.:..   .:
 Frog   145 PVCNRNYLTVTSCFIVCQCGVYINTQSQGMSIEKLHYLLESSLTAHGYHCTEHPVFSVATELGGA 209

  Fly   182 GQLYDMCGSCD 192
            |.|...|.:||
 Frog   210 GSLLMSCHACD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RipalphaNP_609351.1 RPA_interact_C 122..196 CDD:291434 21/77 (27%)
rpainNP_001120254.1 RPA_interact_N 6..43 CDD:373278 9/25 (36%)
RPA_interact_M 57..134 CDD:373279 12/76 (16%)
RPA_interact_C 144..224 CDD:373280 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1518754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.