DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur and MDL2

DIOPT Version :9

Sequence 1:NP_001334732.1 Gene:Sur / 34350 FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_015053.2 Gene:MDL2 / 855858 SGDID:S000006191 Length:773 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:91/266 - (34%)
Similarity:127/266 - (47%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1977 PQRGDIHFDNVSLRYEGQKQ-NVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHI 2040
            |.||.|.|.:||..|..:.. .:..||..||..|..:.|.|.:|.|||::.|.|......|.|.|
Yeast   441 PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505

  Fly  2041 YIDDVDIQRIRPDELRTRLSIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNG-- 2103
            .||:.||.::....||..:.|:.|:..|.:.|||:|: .:|          |.....||.:..  
Yeast   506 TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI-TYG----------LTYTPTKEEIRSVA 559

  Fly  2104 ----------HLPLGLDTVICDGGLNLSAGHRQLLCLARAILRGSVCLVLDEATSVLDSSTESA- 2157
                      ..|...||||...|..||.|.:|.:.:|||:::....|:||||||.||..:|.| 
Yeast   560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624

  Fly  2158 ------LLKAADLAFRGRTIITIAHRLTTILDYDRLIVL-DQGRIVEDGNPRELQQLEGSVFRGL 2215
                  |:|:     :..||::|||||:||...:.:||| ..|.:||.|..:||.....|....|
Yeast   625 NYTFGQLMKS-----KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684

  Fly  2216 L-EKGA 2220
            | ||.|
Yeast   685 LNEKAA 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
MDL2NP_015053.2 3a01208 1..685 CDD:273363 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.