DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur and NAP5

DIOPT Version :9

Sequence 1:NP_001334732.1 Gene:Sur / 34350 FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_177289.1 Gene:NAP5 / 843474 AraportID:AT1G71330 Length:324 Species:Arabidopsis thaliana


Alignment Length:153 Identity:59/153 - (38%)
Similarity:96/153 - (62%) Gaps:6/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   933 KRYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQRQRIAIARAIYSSANVVIMDDPLASLD 997
            :|||.|:|||:|..|:|::..||.::|||||||:||||:|||.||||:|..|::.:.|||.:::|
plant     4 ERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLFDDPFSAVD 68

  Fly   998 NEVGEHIFQHCIREMLQKSNRTFILVTQQLHRIKEAEYLIAIKDGRVEACGSYADIEL----MQP 1058
            ...|.|:|:..:|.:|  .:::.|.||.|:..:..|:..:.:||||:...|.|.||.:    .:.
plant    69 AHTGSHLFKEALRGLL--CSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKYNDILISGTDFRE 131

  Fly  1059 RITAEWNAIIAMAKAKNDNPSQN 1081
            .|.|...::..:..|...:.|:|
plant   132 LIGAHQESLAVVGSADASSVSEN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
NAP5NP_177289.1 P-loop_NTPase <1..112 CDD:304359 48/109 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.