DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13137 and AAAS

DIOPT Version :9

Sequence 1:NP_609350.2 Gene:CG13137 / 34349 FlyBaseID:FBgn0032188 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_011537080.1 Gene:AAAS / 8086 HGNCID:13666 Length:560 Species:Homo sapiens


Alignment Length:482 Identity:110/482 - (22%)
Similarity:188/482 - (39%) Gaps:106/482 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TNAPICNNQQQ---RCVDFVRNNANIGNRTEEVLNLLWELAN---EYWQWFLQKLGQLKRLC--- 66
            |.....::::|   ||::..|:....|     |||   |:||   |.::|.....|....||   
Human    65 TRTAFIHHREQVWKRCINIWRDVGLFG-----VLN---EIANSEEEVFEWVKTASGWALALCRWA 121

  Fly    67 ------------FRPECRIDPEILERISQTRGWKTSVIRFIECHPSSSLMAFLTNDDVVLICDKN 119
                        .|.|     :::...:|...|.:..:|....||.::..|....||.|.:.:.:
Human   122 SSLHGSLFPHLSLRSE-----DLIAEFAQVTNWSSCCLRVFAWHPHTNKFAVALLDDSVRVYNAS 181

  Fly   120 YDCPTKIQSVRQKDTTCVAFRPWSQTCEFAVGCAAGICLWS-DSRRLNANRNIRRMMGTHHLQVL 183
            ......::...|::...:|::|.|.:. .||.|.:.|.:|: |...|:.    |...|.  .|||
Human   182 STIVPSLKHRLQRNVASLAWKPLSASV-LAVACQSCILIWTLDPTSLST----RPSSGC--AQVL 239

  Fly   184 QDKGHNYVTSMQWNEDGTILVTAAFGSSHIMLWEPDCQQKIRLIPNP--KSLGSFSLLRFSPDFH 246
            ...||..|||:.|...|..|::|:...:.|.:|:...:   ..:|.|  :..|..:|| :|||..
Human   240 SHPGHTPVTSLAWAPSGGRLLSASPVDAAIRVWDVSTE---TCVPLPWFRGGGVTNLL-WSPDGS 300

  Fly   247 VLFCAS-------CDAGASLCQLNRSKWKLKQILGQQRIQSAVWTTCGSTLLYACYGSTRVYSCT 304
            .:...:       .:|....|:    :|  ..:.|  |.|:..|:..||.||:...|...:||.:
Human   301 KILATTPSAVFRVWEAQMWTCE----RW--PTLSG--RCQTGCWSPDGSRLLFTVLGEPLIYSLS 357

  Fly   305 -----SDGEDSVFLRPQSIWRVQLIMDLQLVT--TCAGQRLCCGEPQCLAMDPLGIYMASIFKEQ 362
                 .:|:..|    .......::.||...|  |..|:....||...:..||.|..:|.:.|.:
Human   358 FPERCGEGKGCV----GGAKSATIVADLSETTIQTPDGEERLGGEAHSMVWDPSGERLAVLMKGK 418

  Fly   363 SFV-----LLCILHTSRWGNVKLLPVEFIY--CDMDGDQYPAYISFGVLKAE-------IRF--- 410
            ..|     ::.:..|......:|||...:.  |.:      .:.|.|:::.|       |.|   
Human   419 PRVQDGKPVILLFRTRNSPVFELLPCSLLASGCLL------TFSSSGIIQGEPGAQPQLITFHPS 477

  Fly   411 ------LIIAWNTG---HFQRYDITAQ 428
                  |.:.|:||   |...|.:.||
Human   478 FNKGALLSVGWSTGRIAHIPLYFVNAQ 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13137NP_609350.2 WD40 89..357 CDD:295369 68/284 (24%)
WD40 89..>333 CDD:225201 61/260 (23%)
WD40 repeat 135..178 CDD:293791 12/43 (28%)
WD40 repeat 191..229 CDD:293791 9/37 (24%)
WD40 repeat 237..274 CDD:293791 8/43 (19%)
AAASXP_011537080.1 WD40 <133..343 CDD:295369 55/233 (24%)
WD40 154..>413 CDD:225201 68/281 (24%)
WD40 repeat 157..193 CDD:293791 6/35 (17%)
WD40 repeat 197..243 CDD:293791 15/52 (29%)
WD40 repeat 247..283 CDD:293791 10/38 (26%)
WD40 repeat 291..328 CDD:293791 8/43 (19%)
WD40 repeat 356..390 CDD:293791 6/37 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2139
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470197at33208
OrthoFinder 1 1.000 - - FOG0005612
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14494
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.