DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and crp

DIOPT Version :10

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_417816.1 Gene:crp / 947867 ECOCYCID:EG10164 Length:210 Species:Escherichia coli


Alignment Length:92 Identity:25/92 - (27%)
Similarity:42/92 - (45%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 YETDSCIVREGELGNEFYIIRCGTVTIKKLDEQQQEQIVANRKRGDYFGEQALLNADVRQASVYA 635
            |.:.|.::.:||.....|.|..|:|.:...||:.:|.|::...:||:.||..|......:::...
E. coli    24 YPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR 88

  Fly   636 DAPGTEVLMLDREAFISYLGTIKQLRE 662
            .....||      |.|||    |:.|:
E. coli    89 AKTACEV------AEISY----KKFRQ 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 CAP_ED 431..539 CDD:237999
CAP_ED 550..663 CDD:237999 25/92 (27%)
STKc_cGK 700..957 CDD:270724
crpNP_417816.1 PRK11753 1..210 CDD:236969 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.