DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and TPK2

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_015121.1 Gene:TPK2 / 855898 SGDID:S000006124 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:346 Identity:126/346 - (36%)
Similarity:210/346 - (60%) Gaps:25/346 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 QLREKPSSQRND---TSGRSSTKSLEFDNEYSQVAISELKKIATLGCGAFGRVDLV--AYNQQAL 718
            |.|::...||..   .:.:...|||....:|:   :.:.:.:.|||.|:||||.||  .:|.:..
Yeast    35 QQRQQQQQQRQHQQLLTSQLPQKSLVSKGKYT---LHDFQIMRTLGTGSFGRVHLVRSVHNGRYY 96

  Fly   719 ALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLMEACMGGDVWTVMS 783
            |:|::||.:|||..|:||. |::..|:|..:.||:::::.|:::.:.::.:|:...||::::::.
Yeast    97 AIKVLKKQQVVKMKQVEHT-NDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLR 160

  Fly   784 KRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPENLMLGTDGYCKLVDFGFAKFVRQNEKTN 848
            |.|.|....|||.|..|:.|.:|||:|:.|||||||||::|..:|:.|:.||||||.|:  ..|.
Yeast   161 KSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQ--TVTW 223

  Fly   849 TFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLVGKTPFRGVNQIKIYQQILSGIDVIHMPS 913
            |..|||:|:|||:|..:.::::||:|:||:|:||:|.|.|||.....:|.|::||.| .|::.|.
Yeast   224 TLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQG-KVVYPPY 287

  Fly   914 RIPKSAQHLVRHLCKQLPAE---RLGYQRKGIADIKRHSWFESLDWQRLKLKQLPSPIKRPLKSW 975
            ..|    .:|..|.|.:.|:   |:|..:.|..|||.|.||..:.|:||..|.:.:|.:.|:.|.
Yeast   288 FHP----DVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSG 348

  Fly   976 TDLQYFGPSGVENDYEPPEEL 996
                 .|.:.:.:.| |.|:|
Yeast   349 -----IGDTSLFDQY-PEEQL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736
CAP_ED 550..663 CDD:237999 2/3 (67%)
S_TKc 695..951 CDD:214567 104/260 (40%)
STKc_cGK 700..957 CDD:270724 105/261 (40%)
TPK2NP_015121.1 STKc_PKA_like 69..358 CDD:270732 114/301 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.