DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and TPK3

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_012755.1 Gene:TPK3 / 853688 SGDID:S000001649 Length:398 Species:Saccharomyces cerevisiae


Alignment Length:393 Identity:134/393 - (34%)
Similarity:218/393 - (55%) Gaps:46/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   616 DYFGEQALLNADVRQASVYAD-APGTEVLMLDREAFISYLGTIKQ-------LREKPSSQRNDTS 672
            |..|:...:||.    ||:.: :..|.|.:..|.:     |.:|:       |.:||..|..|||
Yeast    25 DNVGQDIPVNAH----SVHEECSSNTPVEINGRNS-----GKLKEEASAGICLVKKPMLQYRDTS 80

  Fly   673 GRSSTKSLEFDNEYSQVAISELKKIATLGCGAFGRVDLVA--YNQQALALKIIKKIEVVKQDQIE 735
            |:.|              :|:.:.:.|||.|:||||.|:.  :|.:..|||.:||..:||..|:|
Yeast    81 GKYS--------------LSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVE 131

  Fly   736 HVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCV 800
            |. |::..|:.....|||::::.|:::.:.|:.:|:...||::::::.|.|.|....|||.|..|
Yeast   132 HT-NDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV 195

  Fly   801 VEAFDYLHSHHFIYRDLKPENLMLGTDGYCKLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDR 865
            ..|.:||||...|||||||||::|..:|:.|:.||||||:|  .:.|.|..|||:|:|||::..:
Yeast   196 CLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV--PDVTYTLCGTPDYIAPEVVSTK 258

  Fly   866 GHDRAVDYWALGILVYELLVGKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQL 930
            .::::||:|:.|:|:||:|.|.|||...|.:|.|:.||:.  .:..|......||.|::.|..:.
Yeast   259 PYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNA--ELKFPPFFHPDAQDLLKKLITRD 321

  Fly   931 PAERLGYQRKGIADIKRHSWFESLDWQRLKLKQLPSPIKRPLKSWT-DLQYFGPSGVENDYEPPE 994
            .:||||..:.|..|:|.|.||..:.|::|..:.:.:|.:.|::... |...|       |..|.|
Yeast   322 LSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQF-------DRYPEE 379

  Fly   995 ELS 997
            |.:
Yeast   380 EFN 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736 9/34 (26%)
CAP_ED 550..663 CDD:237999 12/54 (22%)
S_TKc 695..951 CDD:214567 101/257 (39%)
STKc_cGK 700..957 CDD:270724 102/258 (40%)
TPK3NP_012755.1 STKc_PKA_like 86..376 CDD:270732 111/301 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.