DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and GORK

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_001332118.1 Gene:GORK / 833728 AraportID:AT5G37500 Length:842 Species:Arabidopsis thaliana


Alignment Length:417 Identity:86/417 - (20%)
Similarity:147/417 - (35%) Gaps:119/417 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 HSLIIREHEE-----------GS---EIYVSAEGQYDVI-----RGGQLVASFGPATVFGELAIL 501
            :.::||.|||           |:   .:|...||..:.:     ...:.|...||.|.||:::|:
plant   396 NQIVIRLHEEYFLPGEVITEQGNVVDHLYFVCEGLLEALVTKTDGSEESVTLLGPHTSFGDISII 460

  Fly   502 YNAPRQASIEAATDARVWKIARETFRAIMQ------------ISGSREREENLQFLRS--APFLQ 552
            .|..:..::.......:.::.:::|..|::            |...:|..:.::.|.|  ...:.
plant   461 CNISQPFTVRVCELCHLLRLDKQSFSNILEIYFHDGRTILNNIMEEKESNDRIKKLESDIVIHIG 525

  Fly   553 EFDQSLLLKVVD-LLQRKFYETDSCIVREGELGNE---------------------------FYI 589
            :.:..|.|||.. ..|..||:..| ::|.|...|:                           |||
plant   526 KQEAELALKVNSAAFQGDFYQLKS-LIRSGADPNKTDYDGRSPLVRLSLIDYLSFKSLTLILFYI 589

  Fly   590 IRCGT------VTIKKLDEQQQEQIVANRKRGDYFGEQALLNADVRQASVYADAPGTEVLMLDRE 648
            .....      :|:..:    ||.:..|.|  |.||...|..|      |.|...|...|::...
plant   590 QHLAACRGYEDITLFLI----QEGVDVNLK--DKFGHTPLFEA------VKAGQEGVIGLLVKEG 642

  Fly   649 AFI------SYLGTIKQLREKPSSQRNDTSGRSSTKSLEFDNEYS-QVAISE-----LKKIATLG 701
            |..      ::|.|.....:....:|..:|| .:..|.::|:... .||.||     .|.:...|
plant   643 ASFNLEDSGNFLCTTVAKGDSDFLKRLLSSG-MNPNSEDYDHRTPLHVAASEGLFLMAKMLVEAG 706

  Fly   702 CGA-----FGRVDLVAYNQQALA--LKIIKKIEVVKQDQ-------IEHVYNEKNVMIKCRQSPF 752
            ...     :|...|   ::..|.  .|:||.:|.||..|       :..:..|:....||...||
plant   707 ASVISKDRWGNSPL---DEARLCGNKKLIKLLEDVKNAQSSIYPSSLRELQEERIERRKCTVFPF 768

  Fly   753 IVQLYRTYRNDKYVYFLMEACMGGDVW 779
            ..|..:..|:.|:         |..||
plant   769 HPQEAKEERSRKH---------GVVVW 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736 31/154 (20%)
CAP_ED 431..539 CDD:237999 21/113 (19%)
Crp 544..>650 CDD:223736 30/141 (21%)
CAP_ED 550..663 CDD:237999 31/152 (20%)
S_TKc 695..951 CDD:214567 23/99 (23%)
STKc_cGK 700..957 CDD:270724 22/94 (23%)
GORKNP_001332118.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.