DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and AT3G23310

DIOPT Version :10

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_188973.2 Gene:AT3G23310 / 821911 AraportID:AT3G23310 Length:568 Species:Arabidopsis thaliana


Alignment Length:72 Identity:20/72 - (27%)
Similarity:31/72 - (43%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 VDVVHEFVDKMVVDRICKLKEEGTLGNRSDVLSRIIEIESHKTTDEKDPS-----TIKFFRQF-- 316
            |.|..|.:.:.:...||.|...|.||:.:.....||::.|...|..:.|.     .:.||..|  
plant    48 VVVTEESLHEPMYLLICTLVLNGILGSSTFFPKLIIDLLSSSKTISRAPCLGQAFCVLFFAFFEI 112

  Fly   317 CTSFILA 323
            ||..::|
plant   113 CTFTLMA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 CAP_ED 431..539 CDD:237999
CAP_ED 550..663 CDD:237999
STKc_cGK 700..957 CDD:270724
AT3G23310NP_188973.2 MobB_NDR_LATS-like 54..115 CDD:439267 15/60 (25%)
STKc_NDR_like 118..485 CDD:270750 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.