DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and AT3G06270

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_187278.2 Gene:AT3G06270 / 819801 AraportID:AT3G06270 Length:348 Species:Arabidopsis thaliana


Alignment Length:261 Identity:53/261 - (20%)
Similarity:90/261 - (34%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SGGSAINVIRSSSKLKPVKERRPTALPTEVPSIEIEDV----------RDAKDTGDGMDS--LGE 168
            |.|.:...:.::..||. |:::|.. ...|||...:.|          .|:.|. :..|:  :..
plant    17 SDGDSRGPLEANGVLKG-KDQKPLG-SIHVPSPNFDMVYSVLSQRGYYPDSPDK-ENQDTYCIKT 78

  Fly   169 RVQPGANAH-VDVVDGGGKSKLKVNVNGIIDESVAHDDDYDTPSSNSIATTP-VTEGPVK----F 227
            .:|...|.| ..|.||.|  .|....:..:.|.|.          ..::..| :.|.|.|    .
plant    79 ELQGNPNVHFFGVFDGHG--VLGTQCSNFVKERVV----------EMLSEDPTLLEDPEKAYKSA 131

  Fly   228 FIGHTQELSAQQTDDTLSCQSSDANNNSAAKLTNGVVPQEQPEREMGKQQALQAPPRAKSSSNVS 292
            |:...:||...:.||::|         ....:|..||..:.....:|..:|:.|   .|..:.:.
plant   132 FLRVNEELHDSEIDDSMS---------GTTAITVLVVGDKIYVANVGDSRAVLA---VKDRNRIL 184

  Fly   293 LNYLAKSQTDSQRRR---------RVSTMPDINIPPAPPL------------PPELLV-----PG 331
            ...|:..||..::..         ||.::..:.....|.:            ||.|.|     ||
plant   185 AEDLSYDQTPFRKDECERVKACGARVLSVDQVEGLKDPNIQTWANEESEGGDPPRLWVQNGMYPG 249

  Fly   332 T 332
            |
plant   250 T 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736
CAP_ED 550..663 CDD:237999
S_TKc 695..951 CDD:214567
STKc_cGK 700..957 CDD:270724
AT3G06270NP_187278.2 PP2Cc 68..342 CDD:238083 41/208 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000531
OrthoInspector 1 1.000 - - mtm1102
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.