DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and prkacbb

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:XP_005171151.1 Gene:prkacbb / 563147 ZFINID:ZDB-GENE-050904-4 Length:354 Species:Danio rerio


Alignment Length:354 Identity:132/354 - (37%)
Similarity:201/354 - (56%) Gaps:38/354 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   645 LDREAFI-SYLGTIKQ--LREKPSSQRNDTSGRSSTKSLEFDNEYSQVAISELKKIATLGCGAFG 706
            |:.|.|: .:|...|:  ||:..|.|      :|:|...:||.:            .|||.|:||
Zfish    13 LESETFVKEFLAKAKEDFLRKWESPQ------QSTTCLDDFDRQ------------KTLGTGSFG 59

  Fly   707 RVDLVAY--NQQALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFL 769
            ||.||.:  :.|..|:|::.|.:|||..|:||..|||.: ::....||:|:|...::::..:|.:
Zfish    60 RVLLVKHKASDQYYAMKVLDKQKVVKLKQVEHTLNEKRI-LQAVSFPFLVRLEYAFKDNSNLYMV 123

  Fly   770 MEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPENLMLGTDGYCKLVD 834
            ||...||::::.:.:...|.|..|:|.|..:|..|:||||...||||||||||::...||.::.|
Zfish   124 MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTD 188

  Fly   835 FGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLVGKTPFRGVNQIKIY 899
            |||||  |...:|.|..|||||:||||||.:|:::|||:||||:|:||:..|..||.....|:||
Zfish   189 FGFAK--RVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY 251

  Fly   900 QQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHSWFESLDWQRLKLKQL 964
            ::|:||  .:..||......:.|:|:|.:....:|.|..|.|:.|||.|.||.:.||..:..:::
Zfish   252 EKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKNHKWFATTDWIAIYERKV 314

  Fly   965 PSPIKRPLKSWTDLQYFGPSGVEN--DYE 991
            .:|.....:        ||....|  |||
Zfish   315 EAPFIPKCR--------GPGDTSNFDDYE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736 2/4 (50%)
CAP_ED 550..663 CDD:237999 7/20 (35%)
S_TKc 695..951 CDD:214567 108/257 (42%)
STKc_cGK 700..957 CDD:270724 110/258 (43%)
prkacbbXP_005171151.1 PTZ00263 35..354 CDD:140289 125/332 (38%)
STKc_PKA 45..334 CDD:271111 118/313 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.