DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and Pka-C2

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster


Alignment Length:313 Identity:114/313 - (36%)
Similarity:181/313 - (57%) Gaps:15/313 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 SLEFD---NEYSQVAISELKKI---ATLGCGAFGRVDLV--AYNQQALALKIIKKIEVVKQDQIE 735
            |.||:   |..:|...:.|:..   |.||.|:||.|.||  ...:...|.|::.|.::|:..|:.
  Fly    24 SREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVRLKQVA 88

  Fly   736 HVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCV 800
            ||:|||:|:...| .||::.|..:.:...|:|.::....||::::...:.:.|:||.|:|.|..|
  Fly    89 HVHNEKHVLNAAR-FPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQV 152

  Fly   801 VEAFDYLHSHHFIYRDLKPENLMLGTDGYCKLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDR 865
            ..|.:|:|..|.:||||||||::|...||.|:.||||.|  |.:.:|:|..|||||:||||:..|
  Fly   153 ALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTK--RVDGRTSTLCGTPEYLAPEIVQLR 215

  Fly   866 GHDRAVDYWALGILVYELLVGKTPFRGVNQ--IKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCK 928
            .::::||:||.||||||.:.|::||...|:  |.:|.:|.  |....|||......:.||..|.:
  Fly   216 PYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKIC--ICDYKMPSYFTSQLRSLVESLMQ 278

  Fly   929 QLPAERLGYQRKGIADIKRHSWFESLDWQRLKLKQLPSPIKRPLKSWTDLQYF 981
            ...::|||....|.:|:|.|.||:.:||..:..:::.:|.:..:....||..|
  Fly   279 VDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736
CAP_ED 550..663 CDD:237999
S_TKc 695..951 CDD:214567 100/262 (38%)
STKc_cGK 700..957 CDD:270724 102/260 (39%)
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 108/294 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.