DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and Prkaca

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_001094392.1 Gene:Prkaca / 25636 RGDID:3389 Length:351 Species:Rattus norvegicus


Alignment Length:308 Identity:122/308 - (39%)
Similarity:183/308 - (59%) Gaps:17/308 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   691 ISELKKIATLGCGAFGRVDLVAYNQQA--LALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFI 753
            :....:|.|||.|:||||.||.:.:..  .|:||:.|.:|||..||||..|||.: ::....||:
  Rat    41 LDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRI-LQAVNFPFL 104

  Fly   754 VQLYRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLK 818
            |:|..:::::..:|.:||...||::::.:.:...|.|..|:|.|..:|..|:||||...||||||
  Rat   105 VKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLK 169

  Fly   819 PENLMLGTDGYCKLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYEL 883
            ||||::...||.::.||||||  |...:|.|..|||||:||||||.:|:::|||:||||:|:||:
  Rat   170 PENLLIDQQGYIQVTDFGFAK--RVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM 232

  Fly   884 LVGKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRH 948
            ..|..||.....|:||::|:||  .:..||......:.|:|:|.:....:|.|..:.|:.|||.|
  Rat   233 AAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNH 295

  Fly   949 SWFESLDWQRLKLKQLPSPIKRPLKSWTDLQYFGPSGVEN--DYEPPE 994
            .||.:.||..:..:::.:|.....|        ||....|  |||..|
  Rat   296 KWFATTDWIAIYQRKVEAPFIPKFK--------GPGDTSNFDDYEEEE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736
CAP_ED 550..663 CDD:237999
S_TKc 695..951 CDD:214567 109/257 (42%)
STKc_cGK 700..957 CDD:270724 110/258 (43%)
PrkacaNP_001094392.1 PTZ00426 16..334 CDD:173616 121/305 (40%)
STKc_PKA 42..331 CDD:271111 118/301 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.