DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4839 and LOC110438932

DIOPT Version :9

Sequence 1:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster
Sequence 2:XP_021328180.1 Gene:LOC110438932 / 110438932 -ID:- Length:105 Species:Danio rerio


Alignment Length:94 Identity:31/94 - (32%)
Similarity:49/94 - (52%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 YETDSCIVREGELGNEFYIIRCGTVTIKKLDEQQQEQIVANR-KRGDYFGEQALLNADVRQASVY 634
            |.....|:|:|..|:.|:||..|.|.:.:.|......:.... .:||:|||:||...|:|.|:|.
Zfish     3 YSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVI 67

  Fly   635 ADAPGTEVLMLDREAFISYLGTIKQLREK 663
            | |.....|::|||:|...:|.:..:..|
Zfish    68 A-AEAVTCLVIDRESFKHLIGGLDDVSNK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4839NP_609349.1 Crp 428..577 CDD:223736 1/5 (20%)
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736 28/79 (35%)
CAP_ED 550..663 CDD:237999 30/92 (33%)
S_TKc 695..951 CDD:214567
STKc_cGK 700..957 CDD:270724
LOC110438932XP_021328180.1 CAP_ED 2..87 CDD:237999 29/84 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123183at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.