powered by:
Protein Alignment CG13133 and AT1G52560
DIOPT Version :9
Sequence 1: | NP_609343.1 |
Gene: | CG13133 / 34342 |
FlyBaseID: | FBgn0032181 |
Length: | 217 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_175665.1 |
Gene: | AT1G52560 / 841687 |
AraportID: | AT1G52560 |
Length: | 232 |
Species: | Arabidopsis thaliana |
Alignment Length: | 46 |
Identity: | 11/46 - (23%) |
Similarity: | 19/46 - (41%) |
Gaps: | 1/46 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 FTRSYKLPRHYDATQARATFSADGILMITVPAPPKLDDVEREIEIE 178
:..|..||........:|... :|:|.:.:|...|.....:||.:|
plant 188 YNTSLSLPDDAKVEDIKAELK-NGVLNLVIPRTEKPKKNVQEISVE 232
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
51 |
1.000 |
Domainoid score |
I4315 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I2586 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.060 |
|
Return to query results.
Submit another query.