DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and HSP18.2

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_200780.1 Gene:HSP18.2 / 836093 AraportID:AT5G59720 Length:161 Species:Arabidopsis thaliana


Alignment Length:106 Identity:22/106 - (20%)
Similarity:49/106 - (46%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGTFKVVLDVHHFQI-------SELTVKAKNSDTVCVEGKQADDRAEKGQLC-----ITREFTRS 136
            |..:|...:.|.|:.       .|:.|:.::.:.:.:.|:::.:..||....     .:.:|.|.
plant    53 RVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRR 117

  Fly   137 YKLPRHYDATQARATFSADGILMITVPAPPKLDDVEREIEI 177
            ::||.:....:.:||.. :|:|.:.||..|:.....:.|:|
plant   118 FRLPENAKMEEVKATME-NGVLTVVVPKAPEKKPQVKSIDI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 16/87 (18%)
HSP18.2NP_200780.1 ACD_ScHsp26_like 53..144 CDD:107229 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.