DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and HSP17.6II

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II / 831075 AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana


Alignment Length:100 Identity:24/100 - (24%)
Similarity:49/100 - (49%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FKVVLDVHHFQISELTVKAKNSDTVCVEG-KQADDRAEKGQLCITRE-----FTRSYKLPRHYDA 145
            :..|:|:...:..|:.|:.:|.:.:.|.| :|.:::..:|...:..|     |.|.::||.:.|.
plant    56 YAFVVDMPGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKFMRKFQLPENADL 120

  Fly   146 TQARATFSADGILMITV-----PAPPKLDDVEREI 175
            .:..|. ..||:|.:||     |.|.|...::.::
plant   121 DKISAV-CHDGVLKVTVQKLPPPEPKKPKTIQVQV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 21/86 (24%)
HSP17.6IINP_196763.1 HSP20 48..136 CDD:365807 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.