DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Hspb8

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_109629.1 Gene:Hspb8 / 80888 MGIID:2135756 Length:196 Species:Mus musculus


Alignment Length:119 Identity:37/119 - (31%)
Similarity:54/119 - (45%) Gaps:15/119 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SAWCHGSCLVGRV-----------VIETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVC 112
            ||| .|:...|.|           |...|..|.......:||.::||.|:..||.||.|:. .|.
Mouse    58 SAW-PGTLRSGMVPRGPPATARFGVPAEGRSPPPFPGEPWKVCVNVHSFKPEELMVKTKDG-YVE 120

  Fly   113 VEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARATFSADGILMITVPAPP 166
            |.||..:.:.|.|  .:::.||:..:||...|.....|:.|.:|:|:|..|..|
Mouse   121 VSGKHEEKQQEGG--IVSKNFTKKIQLPAEVDPATVFASLSPEGLLIIEAPQVP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 26/75 (35%)
Hspb8NP_109629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
ACD_HspB8_like 80..170 CDD:107235 29/92 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.