DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and hspb8

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001094427.2 Gene:hspb8 / 791580 ZFINID:ZDB-GENE-030131-2480 Length:216 Species:Danio rerio


Alignment Length:207 Identity:50/207 - (24%)
Similarity:73/207 - (35%) Gaps:63/207 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIHWDWDWEHDHEHGHHHWQPPRRHWSTGESKCRQRHYYLSHDLDVCARDFHLRMDDSAWCHGSC 66
            |.....||.        .|..||                |||.|            |:.|. ||.
Zfish    40 PNELSMDWP--------GWARPR----------------LSHRL------------DAPWT-GSL 67

  Fly    67 LVG-------------RVVIET---GTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEG 115
            ..|             .|..|:   .:.|.:.....:||.::||.|:..||.||.|:. .|.|.|
Zfish    68 RSGFPRASMSSPQGFSSVYTESPRRASAPPTDSDEPWKVCVNVHSFKPEELNVKTKDG-FVEVSG 131

  Fly   116 KQADDRAEKGQLCITREFTRSYKLPRHYDATQARATFSADGILMITVPAPPKLDDVEREIEIEPT 180
            |..:.:.|.|  .:|:.||:..::|...|.....|:.|.:|:|:|.....|.......|:..|  
Zfish   132 KHEEKQDEGG--IVTKNFTKKIQIPLDVDPVTVFASLSPEGVLIIEARQTPPYYLYSNEMPAE-- 192

  Fly   181 GNYFGSVSDPTA 192
                 |:.:|.|
Zfish   193 -----SMEEPEA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 26/75 (35%)
hspb8NP_001094427.2 ACD_HspB8_like 88..178 CDD:107235 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.