DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Hspb3

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:150 Identity:38/150 - (25%)
Similarity:61/150 - (40%) Gaps:27/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ESKCRQRHYYLSHDLDVCARDFHL------RMDDSAWCHGSCLVGRVVIETGTEPDSLGRGTFKV 89
            |:..|.:..:.:..|:.|..|..|      .::|.....|:........::...|...|:..|::
  Rat    11 ETPVRYQEEFEARGLEDCRLDHALYALPGPTIEDLRKARGTPKALAEDSDSAETPPGEGKSRFQI 75

  Fly    90 VLDVHHF-------QISE--LTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDA 145
            :|||..|       |..|  |.:||::       |.:.|:..     .|:|.|||.||||...:.
  Rat    76 LLDVVQFLPEDIIIQTFEGWLLIKAQH-------GTRMDEHG-----FISRSFTRQYKLPDGVET 128

  Fly   146 TQARATFSADGILMITVPAP 165
            ....|....||||::.|..|
  Rat   129 KDLSAILCHDGILVVEVKDP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 26/84 (31%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 2/20 (10%)
ACD_HspB3_Like 65..147 CDD:107232 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.