DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and hspb2

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001017744.1 Gene:hspb2 / 550439 ZFINID:ZDB-GENE-050417-260 Length:169 Species:Danio rerio


Alignment Length:153 Identity:42/153 - (27%)
Similarity:69/153 - (45%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YYLSHDLDVCARDFHLRMDDSAWC--------------HGSCLVGRV--VIETGTEPDSLGRGTF 87
            |.:|.|.::|...   |:.|..:.              ||..:..|:  .:|.|..........:
Zfish    10 YPMSMDYEMCTPP---RIYDQNFAEALSPKELLAPVLYHGYYIRPRINKQLERGFSQVESEDDWY 71

  Fly    88 KVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARATF 152
            :|:|||..|...|::|:..: :.:.|..:.|....:.|  .::|||||:|.||...|....:.:.
Zfish    72 RVLLDVCQFTPDEISVRTVD-NLLEVSARHAQRMDQHG--FVSREFTRTYILPMGVDPLLVQVSL 133

  Fly   153 SADGILMITVPAPPKLDDVEREI 175
            |.||||.|  .||.|.:|:|.:|
Zfish   134 SHDGILCI--QAPRKTEDLEPQI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 25/75 (33%)
hspb2NP_001017744.1 ACD_HspB2_like 63..145 CDD:107231 26/86 (30%)
IbpA <64..162 CDD:223149 31/96 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.