DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and cryabb

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:127 Identity:42/127 - (33%)
Similarity:64/127 - (50%) Gaps:6/127 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSY 137
            :|:|.....:.:..|.:.|||.||...||:||. ..|.:.:..|..|  .:.|...::|||.|.|
Zfish    50 MESGVSEVKMEKDQFSLSLDVKHFAPEELSVKI-IGDFIEIHAKHED--RQDGHGFVSREFLRKY 111

  Fly   138 KLPRHYDATQARATFSADGILMITVPAPPKLDD-VEREIEIEPTGNYFGSVSDPTAPKAIEQ 198
            ::|...|.....::.|:||:|  ||..|.||.| .||.|.|..|.:...:|:.|...|.::|
Zfish   112 RVPVGVDPASITSSLSSDGVL--TVTGPLKLSDGPERTIAIPVTRDDKTTVAGPQKRKKLKQ 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 26/75 (35%)
cryabbXP_021331756.1 Crystallin 1..48 CDD:306911
ACD_HspB4-5-6 56..137 CDD:107233 27/85 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.