DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Hsp22

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster


Alignment Length:124 Identity:46/124 - (37%)
Similarity:66/124 - (53%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHY 143
            |.::.:..:|:.|||..:  |||.||..:...|.||||.....||:|... :|.|.|.:.||..|
  Fly    56 PATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-SRHFLRRFVLPEGY 117

  Fly   144 DATQARATFSADGILMITVPAPPKLDDV--EREIEIEPTGNYFGSVSDPTAPKAIEQAD 200
            :|.:..:|.|:||:|.|:||.||.:.:.  |||:.||.||       :|....|.|..|
  Fly   118 EADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTG-------EPAKKSAEEPND 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 30/75 (40%)
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 38/100 (38%)
metazoan_ACD 61..138 CDD:107247 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.