DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and hspb1

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:96 Identity:33/96 - (34%)
Similarity:51/96 - (53%) Gaps:4/96 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARA 150
            ::|:.|||:||...||.||.|:. .:.:.||..:.:.|.|  .|:|.|||.|.||...|:.:..:
Zfish   101 SWKISLDVNHFSPEELNVKTKDG-VLEITGKHEERKDEHG--FISRCFTRKYTLPPGVDSEKISS 162

  Fly   151 TFSADGILMITVPAP-PKLDDVEREIEIEPT 180
            ..|.:|:|.:..|.| |.:...|..|.:..|
Zfish   163 CLSPEGVLTVEAPLPKPAIQAPEVNIPVNKT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 27/75 (36%)
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 27/77 (35%)
IbpA <94..191 CDD:223149 32/92 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.