DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Hspb9

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001102305.1 Gene:Hspb9 / 363681 RGDID:1309122 Length:203 Species:Rattus norvegicus


Alignment Length:198 Identity:45/198 - (22%)
Similarity:65/198 - (32%) Gaps:47/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HHHWQPPRRHWSTGE---------SKCRQRHYYLSHDLDVCARDFHLRMDDSAWCHGSCLVGRVV 72
            |...|.....:|||:         |:|..  ..||...........|..||.|..|.:       
  Rat    32 HSRMQRVGSSFSTGQREPGENRVASRCPS--VALSERNQAATLPVRLLKDDLAAAHAN------- 87

  Fly    73 IETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGK--QADDRAEKGQLCITREFTR 135
               |.|..|     |::.||.|.|...:|.|:. :...:.|.||  |..:...:|:..:.:...|
  Rat    88 ---GCEEPS-----FQMKLDAHGFAPEDLVVRI-DGQNLMVTGKRQQESNDPSRGRYRLEQSVHR 143

  Fly   136 SYKLPRHYDATQARATFSADGILMI-----TVPAPPKLDDVEREIEIEP-TGNYF----GSVSDP 190
            ..:||...|......:.:..|.|..     .:|.|        |.:..| ||...    ||...|
  Rat   144 QMQLPMTLDPAAMTCSLTPSGHLWFKGQNKCLPLP--------EAQTGPQTGQALRFKRGSSKCP 200

  Fly   191 TAP 193
            ..|
  Rat   201 NPP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 18/82 (22%)
Hspb9NP_001102305.1 ACD_HspB9_like 87..172 CDD:107236 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.