DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and HSPB2

DIOPT Version :10

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001532.1 Gene:HSPB2 / 3316 HGNCID:5247 Length:182 Species:Homo sapiens


Alignment Length:118 Identity:38/118 - (32%)
Similarity:50/118 - (42%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LGRGTFKVVLDVHHFQISELTVK-AKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDA 145
            |..|.|:..|||.||...|:||: ..|...|.....|..||    ...::|||.|:|.||...|.
Human    69 LSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDR----HGFVSREFCRTYVLPADVDP 129

  Fly   146 TQARATFSADGILMI-------------------TVPAPPKLDDVEREIEIEP 179
            .:.||..|.||||.:                   .:||||..::.|....:||
Human   130 WRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 29/95 (31%)
HSPB2NP_001532.1 Crystallin <21..51 CDD:425732
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 31/82 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.