DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Cryab

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_037067.1 Gene:Cryab / 25420 RGDID:2414 Length:175 Species:Rattus norvegicus


Alignment Length:180 Identity:51/180 - (28%)
Similarity:72/180 - (40%) Gaps:43/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HHHW--------QPPRRHWST--GESKCRQRHYYLSHDLDVCARD---FHLR----MDDSAWCHG 64
            ||.|        ..|.|.:..  ||       :.|..||...|..   |:||    :...:|   
  Rat     6 HHPWIRRPFFPFHSPSRLFDQFFGE-------HLLESDLFSTATSLSPFYLRPPSFLRAPSW--- 60

  Fly    65 SCLVGRVVIETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCI 129
                    |:||.....:.:..|.|.|||.||...||.||.. .|.:.|.||..:.:.|.|  .|
  Rat    61 --------IDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVL-GDVIEVHGKHEERQDEHG--FI 114

  Fly   130 TREFTRSYKLPRHYDATQARATFSADGILMITVP-----APPKLDDVERE 174
            :|||.|.|::|...|.....::.|:||:|.:..|     .|.:...:.||
  Rat   115 SREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQASGPERTIPITRE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 29/75 (39%)
CryabNP_037067.1 Crystallin 1..52 CDD:395419 14/52 (27%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 30/85 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..175 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.