DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Hspb1

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:110 Identity:41/110 - (37%)
Similarity:55/110 - (50%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARAT 151
            ::|.|||:||...|||||.|.. .|.:.||..:.:.|.|.  |:|.|||.|.||...|.|...::
  Rat    99 WRVSLDVNHFAPEELTVKTKEG-VVEITGKHEERQDEHGY--ISRCFTRKYTLPPGVDPTLVSSS 160

  Fly   152 FSADGILMITVPAP-PKLDDVEREIEIEPTGNYFGSVSDPTAPKA 195
            .|.:|.|  ||.|| ||......||.|..|......:..|.:.::
  Rat   161 LSPEGTL--TVEAPLPKAVTQSAEITIPVTFEARAQIGGPESEQS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/75 (41%)
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 41/110 (37%)
ACD_HspB1_like 88..173 CDD:107230 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.