DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Cryaa

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:80 Identity:31/80 - (38%)
Similarity:44/80 - (55%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQA 148
            |..|.:.|||.||...:||||.. .|.|.:.||..:.:.:.|.  |:|||.|.|:||.:.|.:..
  Rat    91 RDKFVIFLDVKHFSPEDLTVKVL-EDFVEIHGKHNERQDDHGY--ISREFHRRYRLPSNVDQSAL 152

  Fly   149 RATFSADGILMITVP 163
            ..:.||||:|..:.|
  Rat   153 SCSLSADGMLTFSGP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 29/75 (39%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 31/80 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.