DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and F58H7.1

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001343638.1 Gene:F58H7.1 / 186550 WormBaseID:WBGene00019067 Length:692 Species:Caenorhabditis elegans


Alignment Length:162 Identity:32/162 - (19%)
Similarity:50/162 - (30%) Gaps:51/162 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CHGSCLVGRVVIE-----------------TGTEPDSLGRGTFKVVLDVHHFQISELTV------ 103
            ||..|....:|:.                 :||...:..|...||.:..:....:||.|      
 Worm   391 CHKICWTTDLVLSSGFGDFTKHLGSECKEISGTTSTTFLRNIKKVSVIENQLSENELVVETEVPE 455

  Fly   104 -----------KAKNSDTVCVEGKQADDRAEKGQLCITREFTRSY--------KLPRHYDATQAR 149
                       |...:||.....|..|.....|:..:..|....|        |.|.||   .::
 Worm   456 SEYGIVTLILQKLGGNDTEEPVKKTFDTATSNGRFVVPVEDDAIYAVIYEYLKKKPFHY---TSK 517

  Fly   150 ATFSADG-ILMITVPAPPKLDDVEREIEIEPT 180
            |.|..:. .:..|.|:.|.:|     :.:.||
 Worm   518 AHFLVESPAINSTKPSHPLVD-----VSVIPT 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 20/101 (20%)
F58H7.1NP_001343638.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.