DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and hsp-43

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001123107.2 Gene:hsp-43 / 180895 WormBaseID:WBGene00002024 Length:393 Species:Caenorhabditis elegans


Alignment Length:222 Identity:51/222 - (22%)
Similarity:84/222 - (37%) Gaps:43/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WQPPRRHWSTGESKCRQRHYYLSHDLDVCARDFHL-----------------RMD-----DSAWC 62
            |....|.|.....|.|...:..|.|:|...:|:..                 |||     |..|.
 Worm    22 WLDDFRDWPLDWPKPRDFFHRFSRDVDSWWKDWPTDWPRMDAVMPRFSSQLDRMDRNWRSDPYWM 86

  Fly    63 HGSCLVGRVVIETGTEPDS---LGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEK 124
            :........:.:.|.:.:|   .....|.|.:|.:.|:..|:.||..: ||:.:||:..|.|.:.
 Worm    87 NLYPRWAEPIFKEGIDVNSNVVNDDRRFAVDMDCYQFRPEEIQVKTLD-DTLMIEGRHEDIRDKD 150

  Fly   125 GQLCITR-EFTRSYKLPRHYDATQARATFSADGILMITVPAPPKLDDV-----EREIEIEPTGNY 183
            .   .|: .|.|.|:|||..|....:::..|.|.|.:..   .|.:::     ||.|.||..|::
 Worm   151 N---FTKMYFVRKYQLPRDVDFNSIQSSIDAKGRLQVEA---GKFNNMALQGRERMIPIEGAGHH 209

  Fly   184 F-----GSVSDPTAPKAIEQADVDGDG 205
            .     |::.....|.:......:.||
 Worm   210 SPRFENGTLRSQRGPNSPIHVQTEHDG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 24/76 (32%)
hsp-43NP_001123107.2 metazoan_ACD 107..186 CDD:107247 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.