DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Hspb2

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_569115.1 Gene:Hspb2 / 161476 RGDID:70914 Length:182 Species:Rattus norvegicus


Alignment Length:118 Identity:38/118 - (32%)
Similarity:50/118 - (42%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LGRGTFKVVLDVHHFQISELTVK-AKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDA 145
            |..|.|:..|||.||...|:||: ..|...|.....|..||    ...::|||.|:|.||...|.
  Rat    69 LSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDR----HGFVSREFCRTYVLPADVDP 129

  Fly   146 TQARATFSADGILMI-------------------TVPAPPKLDDVEREIEIEP 179
            .:.||..|.||||.:                   .:||||..::.|....:||
  Rat   130 WRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEVARVEP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 29/95 (31%)
Hspb2NP_569115.1 Crystallin <16..51 CDD:395419
alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 31/82 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.