DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Cryaa

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa / 12954 MGIID:88515 Length:202 Species:Mus musculus


Alignment Length:80 Identity:31/80 - (38%)
Similarity:44/80 - (55%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQA 148
            |..|.:.|||.||...:||||.. .|.|.:.||..:.:.:.|.  |:|||.|.|:||.:.|.:..
Mouse    97 RDKFVIFLDVKHFSPEDLTVKVL-EDFVEIHGKHNERQDDHGY--ISREFHRRYRLPSNVDQSAL 158

  Fly   149 RATFSADGILMITVP 163
            ..:.||||:|..:.|
Mouse   159 SCSLSADGMLTFSGP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 29/75 (39%)
CryaaNP_001265498.1 Crystallin 1..50 CDD:278926
alpha-crystallin-Hsps_p23-like 90..174 CDD:294116 31/80 (39%)
IbpA <93..174 CDD:223149 31/80 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.