DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and Hspb8

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_446064.1 Gene:Hspb8 / 113906 RGDID:71003 Length:196 Species:Rattus norvegicus


Alignment Length:119 Identity:37/119 - (31%)
Similarity:54/119 - (45%) Gaps:15/119 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SAWCHGSCLVGRV-----------VIETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVC 112
            ||| .|:...|.|           |...|..|.......:||.::||.|:..||.||.|:. .|.
  Rat    58 SAW-PGTLRSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDG-YVE 120

  Fly   113 VEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARATFSADGILMITVPAPP 166
            |.||..:.:.|.|  .:::.||:..:||...|.....|:.|.:|:|:|..|..|
  Rat   121 VSGKHEEKQQEGG--IVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 26/75 (35%)
Hspb8NP_446064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
ACD_HspB8_like 80..170 CDD:107235 29/92 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.