DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and CRYAA2

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001300979.1 Gene:CRYAA2 / 102724652 -ID:- Length:173 Species:Homo sapiens


Alignment Length:121 Identity:41/121 - (33%)
Similarity:60/121 - (49%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RVVIETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFT 134
            |.|:::|.......|..|.:.|||.||...:||||.:: |.|.:.||..:.:.:.|.  |:|||.
Human    54 RTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQD-DFVEIHGKHNERQDDHGY--ISREFH 115

  Fly   135 RSYKLPRHYDATQARATFSADGILMITVPAPPKLD------DVEREI----EIEPT 180
            |.|:||.:.|.:....:.||||:|..   ..||:.      ..||.|    |.:||
Human   116 RRYRLPSNVDQSALSCSLSADGMLTF---CGPKIQTGLDATHAERAIPVSREEKPT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 29/75 (39%)
CRYAA2NP_001300979.1 Crystallin 1..51 CDD:395419
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 31/90 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.