DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and hspb6

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:104 Identity:39/104 - (37%)
Similarity:47/104 - (45%) Gaps:3/104 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYK 138
            |.|.....|.:..|.|:|||.||...|||||.. .|.|.|..|..:...|.|  .|:|||.|.||
 Frog    63 EAGLSEVKLDKDQFSVLLDVKHFSPEELTVKVV-GDYVEVHAKHEERPDEHG--FISREFHRRYK 124

  Fly   139 LPRHYDATQARATFSADGILMITVPAPPKLDDVEREIEI 177
            :|.........:..||:|:|.|..|........||.|.|
 Frog   125 IPPTVSPAAISSALSAEGLLSIQAPVTAGGKQEERSIPI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/75 (41%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148
ACD_HspB4-5-6 68..149 CDD:107233 32/83 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.