DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and LOC100491399

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_002939080.1 Gene:LOC100491399 / 100491399 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:145 Identity:38/145 - (26%)
Similarity:59/145 - (40%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITRE-FTRSYKL 139
            |::..:..:| |.:.|.|..|...|||||......:....|::.....||......: |.:...|
 Frog    75 GSDAKATDKG-FTLCLGVEDFSPEELTVKLLGRKLLVTGAKESKCNDGKGSFSYKCQIFRKEADL 138

  Fly   140 PRHYDATQARATFSADGILMITVPAPPKLDDVE--REIEIEPTGNYFGSVSDPTAPKAIEQADVD 202
            |.:....:...|.:|:|.|:|  .||..|...|  |.:.|:.||:       |...:|.|.:. :
 Frog   139 PMNVREDKLSCTMTAEGKLLI--EAPEGLSPAEEGRNVPIQLTGS-------PAITQATEGSS-E 193

  Fly   203 GDGGEANPAGTAMDK 217
            |......|....|||
 Frog   194 GIKEPETPNPKLMDK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 20/76 (26%)
LOC100491399XP_002939080.1 alpha-crystallin-Hsps_p23-like 84..163 CDD:381838 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.