DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and hsp30d

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_002937646.1 Gene:hsp30d / 100489362 XenbaseID:XB-GENE-5917036 Length:215 Species:Xenopus tropicalis


Alignment Length:185 Identity:55/185 - (29%)
Similarity:73/185 - (39%) Gaps:34/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KCRQRHY-YLSHDLDVCARDFHLRMDDSAWCHGSCLVGRVVIETGTEPDS--LGRGTFKVVLDVH 94
            :|....| .||.|:|:      .|:.|.:      ...|.....||.|.|  .|:..|::.|||.
 Frog    51 QCVNEAYRLLSQDMDM------RRITDQS------RQPRAAETEGTSPSSGKDGKDHFELTLDVR 103

  Fly    95 HFQISELTVKAKNSDTVCVEGKQ--ADDRAEKGQLCITREFTRSYKLPRHYDATQARATFSADGI 157
            .|...|||||.:.. .|.|.|||  ..|..:.......||:.|..:||...:..|...:||.||.
 Frog   104 DFSPHELTVKMQGR-RVIVTGKQERKSDSEDGSYFHEYREWKREAELPEGVNPEQVVCSFSKDGH 167

  Fly   158 LMITVP---APPKLDDVEREIEIEPTGNYFGSVSDPTAPKAIEQADVDGDGGEAN 209
            |.|..|   .||.   .||.|.|.         .|| ||:..::...|.....|:
 Frog   168 LHIQAPRLALPPA---PERPIPIS---------MDP-APRDAQEIPPDAQNSNAD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 28/77 (36%)
hsp30dXP_002937646.1 ACD_HspB9_like 88..174 CDD:107236 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.